-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAPRE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 134-268 of human MAPRE1 (NP_036457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MAPRE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 134-268 of human MAPRE1 (NP_036457.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09860A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAPRE1 |
| Target Synonyms | EB1; MAPRE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat heart, B-cell, HT-29, LO2, Mouse lung, Mouse spleen, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 134-268 of human MAPRE1 (NP_036457.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY | Uniprot ID | Q15691 |
Uniprot Id
Q15691
Target Species
Human
Target Name
MAPRE1
Target Full Name
Microtubule-associated protein RP/EB family member 1
Target Function
Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules. Acts as a regulator of autophagosome transport via interaction with CAMSAP2. May play a role in cell migration.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Golgi apparatus.
Target Protein Families
MAPRE family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
5530600P05Rik; Adenomatous polyposis coli binding protein EB 1; Adenomatous polyposis coli binding protein EB1; AI462499; AI504412; APC binding protein EB 1; APC binding protein EB1 ; APC-binding protein EB1; AW260097; BIM1p; D2Ertd459e; EB 1; EB1; End binding protein 1 ; End-binding protein 1; fa01e12; fc23e11; fi33c06; MAPRE 1; MAPRE1; Mapre3; MARE1_HUMAN; MGC117374; MGC129946; MGC52508 ; Microtubule associated protein RP/EB family member 1; Microtubule-associated protein RP/EB family member 1; wu:fa01e12; wu:fc23e11; wu:fi33c06; zgc:55428; zgc:77807; zgc:85755
Target Background
The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family.
Notification