Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARCH8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 232-291 of human MARCH8 (NP_659458.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MARCH8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 232-291 of human MARCH8 (NP_659458.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03356A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 8-Mar |
| Target Synonyms | MIR; CMIR; c-MIR; MARCH8; RNF178; MARCH-VIII | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, Mouse testis, Rat liver, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 232-291 of human MARCH8 (NP_659458.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV | Uniprot ID | Q5T0T0 |
Uniprot Id
Q5T0T0
Target Species
Human
Target Name
MARCHF8
Target Full Name
E3 ubiquitin-protein ligase MARCHF8
Target Function
E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
Target Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.
Target Tissue Specificity
Broadly expressed. Present in immature dendritic cells (at protein level).
Target Synonyms
MARCHF8; MARCH8; MIR; RNF178; E3 ubiquitin-protein ligase MARCHF8; Cellular modulator of immune recognition; c-MIR; Membrane-associated RING finger protein 8; Membrane-associated RING-CH protein VIII; MARCH-VIII; RING finger protein 178; RING-type E3 ubiquitin transferase MARCHF8
Target Background
MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
