-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARCKS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MARCKS (NP_002347.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MARCKS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MARCKS (NP_002347.5) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06494A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARCKS |
| Target Synonyms | MACS; 80K-L; PKCSL; PRKCSL; MARCKS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MARCKS (NP_002347.5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGA | Uniprot ID | P29966 |
Uniprot Id
P29966
Target Species
Human
Target Name
MARCKS
Target Full Name
Myristoylated alanine-rich C-kinase substrate
Target Function
MARCKS is the most prominent cellular substrate for protein kinase C. This protein binds calmodulin, actin, and synapsin. MARCKS is a filamentous (F) actin cross-linking protein.
Target Subcellular Location
Cytoplasm, cytoskeleton. Membrane; Lipid-anchor.
Target Protein Families
MARCKS family
Target Synonyms
80 kDa protein; 80K L; 80K L protein; 80K-L protein; 80KL; 81 kDa protein; light chain; light chain; MACS; MARCKS; MARCS; MARCS_HUMAN; MGC52672; myristoylated alanine rich C kinase substrate; Myristoylated alanine rich protein kinase C substrate (MARCKS; 80K L); Myristoylated alanine rich protein kinase C substrate; Myristoylated alanine-rich C-kinase substrate; Phosphomyristin; PKCSL; PRKCSL; protein kinase C substrate 80 kDa protein light chain; Protein kinase C substrate
Target Background
The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis.
Notification