-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-700 of human MARK1 (NP_061120.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MARK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 560-700 of human MARK1 (NP_061120.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09016A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARK1 |
| Target Synonyms | MARK; Par1c; Par-1c; MARK1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 560-700 of human MARK1 (NP_061120.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSL | Uniprot ID | Q9P0L2 |
Uniprot Id
Q9P0L2
Target Species
Human
Target Name
MARK1
Target Full Name
Serine/threonine-protein kinase MARK1
Target Function
Serine/threonine-protein kinase. Involved in cell polarity and microtubule dynamics regulation. Phosphorylates DCX, MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU. Involved in cell polarity by phosphorylating the microtubule-associated proteins MAP2, MAP4 and MAPT/TAU at KXGS motifs, causing detachment from microtubules, and their disassembly. Involved in the regulation of neuronal migration through its dual activities in regulating cellular polarity and microtubule dynamics, possibly by phosphorylating and regulating DCX. Also acts as a positive regulator of the Wnt signaling pathway, probably by mediating phosphorylation of dishevelled proteins (DVL1, DVL2 and/or DVL3).
Target Involvement
Genetic variations in MARK1 may be associated with susceptibility to autism. MARK1 is overexpressed in the prefrontal cortex of patients with autism and causes changes in the function of cortical dendrites.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton. Cytoplasm. Cell projection, dendrite.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Target Tissue Specificity
Highly expressed in heart, skeletal muscle, brain, fetal brain and fetal kidney.
Target Synonyms
KIAA1477; MAP/microtubule affinity regulating kinase 1; MAP/microtubule affinity-regulating kinase 1; MARK 1; MARK; Mark1; MARK1_HUMAN; MGC126512; MGC126513; Serine/threonine protein kinase MARK1; Serine/threonine-protein kinase MARK1
Target Background
Enables several functions, including ATP binding activity; phospholipid binding activity; and protein kinase activity. Involved in intracellular signal transduction and protein phosphorylation. Located in cytoplasm; dendrite; and plasma membrane.
Notification