Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MARK3 (NP_001122390.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MARK3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MARK3 (NP_001122390.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04325A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARK3 |
| Target Synonyms | KP78; VIPB; CTAK1; PAR1A; Par-1a; MARK3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MARK3 (NP_001122390.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKL | Uniprot ID | P27448 |
Uniprot Id
P27448
Target Species
Human
Target Name
MARK3
Target Full Name
MAP/microtubule affinity-regulating kinase 3
Target Function
Serine/threonine-protein kinase. Involved in the specific phosphorylation of microtubule-associated proteins for MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU. Phosphorylates CDC25C on 'Ser-216'. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus. Negatively regulates the Hippo signaling pathway and antagonizes the phosphorylation of LATS1. Cooperates with DLG5 to inhibit the kinase activity of STK3/MST2 toward LATS1.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cell projection, dendrite. Cytoplasm.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
C-TAK1; Cdc25C associated protein kinase 1; Cdc25C-associated protein kinase 1; cTAK1; ELKL motif kinase 2; EMK-2; Emk2; ETK 1; KIAA4230; KP78; MAP microtubule affinity regulating kinase 3; MAP/microtubule affinity-regulating kinase 3; Mark3; MARK3_HUMAN; Par 1a; PAR1A; Protein kinase STK10; Ser/Thr protein kinase PAR-1; Serine threonine protein kinase p78 ; Serine/threonine-protein kinase p78; SerThr protein kinase PAR 1
Target Background
The protein encoded by this gene is activated by phosphorylation and in turn is involved in the phosphorylation of tau proteins MAP2 and MAP4. Several transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
