Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARVELD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human MARVELD2 (NP_001033692.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MARVELD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human MARVELD2 (NP_001033692.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06304A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARVELD2 |
| Target Synonyms | Tric; DFNB49; MARVD2; MRVLDC2; MARVELD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human MARVELD2 (NP_001033692.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPTLHDSERAVSADPLPPPPLPLQPPFGPDFYSSDTEEPAIAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHRSPLNSCKDPYGGSEGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYNLRYSYMKSWAGLLRI | Uniprot ID | Q8N4S9 |
Uniprot Id
Q8N4S9
Target Species
Human
Target Name
MARVELD2
Target Full Name
MARVEL domain-containing protein 2
Target Function
Plays a role in the formation of tricellular tight junctions and of epithelial barriers. Required for normal hearing via its role in the separation of the endolymphatic and perilymphatic spaces of the organ of Corti in the inner ear, and for normal survival of hair cells in the organ of Corti.
Target Involvement
Deafness, autosomal recessive, 49 (DFNB49)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Target Synonyms
MARVELD2; TRIC; MARVEL domain-containing protein 2; Tricellulin
Target Background
The protein encoded by this gene is a membrane protein found at the tight junctions between epithelial cells. The encoded protein helps establish epithelial barriers such as those in the organ of Corti, where these barriers are required for normal hearing. Defects in this gene are a cause of deafness autosomal recessive type 49 (DFNB49). Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
