Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Matrin 3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 747-847 of human Matrin 3 (NP_001181884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Matrin 3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 747-847 of human Matrin 3 (NP_001181884.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03627A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Matrin 3 |
| Target Synonyms | MPD2; ALS21; VCPDM; Matrin 3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, 293T, HepG2, K-562, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 747-847 of human Matrin 3 (NP_001181884.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSENADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEERRQKKET | Uniprot ID | P43243 |
Uniprot Id
P43243
Target Species
Human
Target Name
MATR3
Target Full Name
Matrin-3
Target Function
May play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. In association with the SFPQ-NONO heteromer may play a role in nuclear retention of defective RNAs. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway. May bind to specific miRNA hairpins.
Target Involvement
Amyotrophic lateral sclerosis 21 (ALS21)
Target Subcellular Location
Nucleus matrix.
Target Synonyms
ALS21; KIAA0723; Matr3; MATR3_HUMAN; Matrin-3; Matrin3; MPD2; VCPDM; Vocal cord and pharyngeal weakness with distal myopathy
Target Background
This gene encodes a nuclear matrix protein, which is proposed to stabilize certain messenger RNA species. Mutations of this gene are associated with distal myopathy 2, which often includes vocal cord and pharyngeal weakness. Alternatively spliced transcript variants, including read-through transcripts composed of the upstream small nucleolar RNA host gene 4 (non-protein coding) and matrin 3 gene sequence, have been identified. Pseudogenes of this gene are located on chromosomes 1 and X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
