-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MAVS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human MAVS mAb (NP_065797.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against MAVS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human MAVS mAb (NP_065797.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15881A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MAVS |
| Target Synonyms | IPS1; VISA; IPS-1; CARDIF; MAVS | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 121-220 of human MAVS mAb (NP_065797.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGP | Uniprot ID | Q7Z434 |
Uniprot Id
Q7Z434
Target Species
Human
Target Name
MAVS
Target Full Name
Mitochondrial antiviral-signaling protein
Target Function
Required for innate immune defense against viruses. Acts downstream of DHX33, DDX58/RIG-I and IFIH1/MDA5, which detect intracellular dsRNA produced during viral replication, to coordinate pathways leading to the activation of NF-kappa-B, IRF3 and IRF7, and to the subsequent induction of antiviral cytokines such as IFNB and RANTES (CCL5). Peroxisomal and mitochondrial MAVS act sequentially to create an antiviral cellular state. Upon viral infection, peroxisomal MAVS induces the rapid interferon-independent expression of defense factors that provide short-term protection, whereas mitochondrial MAVS activates an interferon-dependent signaling pathway with delayed kinetics, which amplifies and stabilizes the antiviral response. May activate the same pathways following detection of extracellular dsRNA by TLR3. May protect cells from apoptosis.
Target Subcellular Location
Mitochondrion outer membrane. Mitochondrion. Peroxisome.
Target Tissue Specificity
Present in T-cells, monocytes, epithelial cells and hepatocytes (at protein level). Ubiquitously expressed, with highest levels in heart, skeletal muscle, liver, placenta and peripheral blood leukocytes.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CARD adapter inducing interferon beta; CARD adaptor inducing IFN beta; Cardif; DKFZp666M015; FLJ27482; FLJ41962; IFN B promoter stimulator 1; Interferon beta promoter stimulator protein 1; Ips 1; IPS-1; Ips1; KIAA1271; MAVS; MAVS_HUMAN; Mitochondrial anti viral signaling protein; Mitochondrial Antiviral Signaling; Mitochondrial antiviral signaling protein; Mitochondrial antiviral-signaling protein; Putative NF kappa B activating protein 031N; Putative NF-kappa-B-activating protein 031N; Virus induced signaling adapter; virus induced signaling adaptor; Virus-induced-signaling adapter; VISA
Target Background
This gene encodes an intermediary protein necessary in the virus-triggered beta interferon signaling pathways. It is required for activation of transcription factors which regulate expression of beta interferon and contributes to antiviral innate immunity.
Notification