-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MBD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MBD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13209A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MBD2 |
| Target Synonyms | DMTase; NY-CO-41; MBD2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT | Uniprot ID | Q9UBB5 |
Uniprot Id
Q9UBB5
Target Species
Human
Target Name
MBD2
Target Full Name
Methyl-CpG-binding domain protein 2
Target Function
Binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binds hemimethylated DNA as well. Recruits histone deacetylases and DNA methyltransferases. Acts as transcriptional repressor and plays a role in gene silencing. Functions as a scaffold protein, targeting GATAD2A and GATAD2B to chromatin to promote repression. May enhance the activation of some unmethylated cAMP-responsive promoters.
Target Subcellular Location
Nucleus. Note=Nuclear, in discrete foci. Detected at replication foci in late S phase.
Target Tissue Specificity
Highly expressed in brain, heart, kidney, stomach, testis and placenta.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Demethylase; DMTase; MBD 2; Mbd2; MBD2_HUMAN; MBD2a; Methyl CpG binding domain protein 2; Methyl CpG binding protein MBD2; Methyl-CpG-binding domain protein 2; Methyl-CpG-binding protein MBD2; NY CO 41
Target Background
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. Two transcript variants encoding different isoforms have been found for this gene.
Notification