-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MBD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MBD3 (O95983) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MBD3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MBD3 (O95983) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14002A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MBD3 |
| Target Synonyms | MBD3; methyl-CpG-binding domain protein 3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Mouse brain, Mouse lung, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MBD3 (O95983). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALP | Uniprot ID | O95983 |
Uniprot Id
O95983
Target Species
Human
Target Name
MBD3
Target Full Name
Methyl-CpG-binding domain protein 3
Target Function
Acts as transcriptional repressor and plays a role in gene silencing. Does not bind to DNA by itself. Binds to DNA with a preference for sites containing methylated CpG dinucleotides (in vitro). Binds to a lesser degree DNA containing unmethylated CpG dinucleotides. Recruits histone deacetylases and DNA methyltransferases.
Target Subcellular Location
Nucleus. Chromosome. Note=Nuclear, in discrete foci. Detected on chromatin, at promoter regions of active genes.
Target Synonyms
AI181826; AU019209; MBD 3; Mbd3; MBD3: methyl CpG binding domain protein 3; MBD3_HUMAN; Methyl CpG binding domain protein 3; Methyl CpG binding protein MBD3; Methyl-CpG-binding domain protein 3; Methyl-CpG-binding protein MBD3
Target Background
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. This gene belongs to a family of nuclear proteins which are characterized by the presence of a methyl-CpG binding domain (MBD). The encoded protein is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. Unlike the other family members, the encoded protein is not capable of binding to methylated DNA. The protein mediates the association of metastasis-associated protein 2 with the core histone deacetylase complex. Alternative splicing results in multiple transcript variants of this gene.
Notification