-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MC1 Receptor was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human MC1 Receptor (NP_002377.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MC1 Receptor was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human MC1 Receptor (NP_002377.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06204A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MC1 Receptor |
| Target Synonyms | CMM5; MSH-R; SHEP2; MC1 Receptor | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat skin | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human MC1 Receptor (NP_002377.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVVATIAKNRNLHSPMYCFICCL | Uniprot ID | Q01726 |
Uniprot Id
Q01726
Target Species
Human
Target Name
MC1R
Target Full Name
Melanocyte-stimulating hormone receptor
Target Function
Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via regulation of cAMP signaling in melanocytes.
Target Involvement
Melanoma, cutaneous malignant 5 (CMM5)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in melanocytes. Expressed in corticoadrenal tissue.
Target Research Area
Signal Transduction
Target Synonyms
MSH-R;Melanocortin receptor 1;MC1-R
Target Background
This intronless gene encodes the receptor protein for melanocyte-stimulating hormone (MSH). The encoded protein, a seven pass transmembrane G protein coupled receptor, controls melanogenesis. Two types of melanin exist: red pheomelanin and black eumelanin. Gene mutations that lead to a loss in function are associated with increased pheomelanin production, which leads to lighter skin and hair color. Eumelanin is photoprotective but pheomelanin may contribute to UV-induced skin damage by generating free radicals upon UV radiation. Binding of MSH to its receptor activates the receptor and stimulates eumelanin synthesis. This receptor is a major determining factor in sun sensitivity and is a genetic risk factor for melanoma and non-melanoma skin cancer. Over 30 variant alleles have been identified which correlate with skin and hair color, providing evidence that this gene is an important component in determining normal human pigment variation.
Notification