Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 191-390 of human MCAT (NP_775738.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MCAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 191-390 of human MCAT (NP_775738.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04813A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCAT |
| Target Synonyms | MT; MCT; MCT1; fabD; NET62; FASN2C; MCAT | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 191-390 of human MCAT (NP_775738.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR | Uniprot ID | Q8IVS2 |
Uniprot Id
Q8IVS2
Target Species
Human
Target Name
MCAT
Target Full Name
Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
Target Function
Catalyzes the transfer of a malonyl moiety from malonyl-CoA to the free thiol group of the phosphopantetheine arm of the mitochondrial ACP protein (NDUFAB1). This suggests the existence of the biosynthesis of fatty acids in mitochondria.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Type II malonyltransferase family
Target Synonyms
[Acyl-carrier-protein] malonyltransferase; FabD; FABD_HUMAN; FASN 2C; FASN2C; Malonyl CoA acyl carrier protein transacylase; Malonyl CoA acyl carrier protein transacylase mitochondrial; Malonyl CoA:ACP acyltransferase (mitochondrial); Malonyl CoA:ACP acyltransferase; Malonyl CoA:acyl carrier protein transacylase mitochondrial; Malonyl-CoA-acyl carrier protein transacylase; Mcat; MCT; MCT1; MGC47838; mitochondrial; Mitochondrial malonyl CoA:ACP acyltransferase; Mitochondrial malonyltransferase; NET62
Target Background
The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
