Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCF2L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 850-980 of human MCF2L (NP_079255.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MCF2L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 850-980 of human MCF2L (NP_079255.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00840A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCF2L |
| Target Synonyms | DBS; OST; ARHGEF14; MCF2L | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, MCF7, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 850-980 of human MCF2L (NP_079255.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEK | Uniprot ID | O15068 |
Uniprot Id
O15068
Target Species
Human
Target Name
MCF2L
Target Full Name
Guanine nucleotide exchange factor DBS
Target Function
Guanine nucleotide exchange factor that catalyzes guanine nucleotide exchange on RHOA and CDC42, and thereby contributes to the regulation of RHOA and CDC42 signaling pathways. Seems to lack activity with RAC1. Becomes activated and highly tumorigenic by truncation of the N-terminus. Isoform 5 activates CDC42.; Does not catalyze guanine nucleotide exchange on CDC42.
Target Subcellular Location
[Isoform 5]: Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 3]: Cytoplasm. Endomembrane system.; Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
MCF2 family
Target Synonyms
ARHGEF 14; DBL''s big sister; DBS; FLJ12122; Guanine nucleotide exchange factor DBS; KIAA0362; MCF 2L; MCF.2 cell line derived transforming sequence like; MCF.2 transforming sequence-like; MCF2 like protein; MCF2 transforming sequence like protein; MCF2-transforming sequence-like protein; Mcf2l; MCF2L_HUMAN; OST; OST oncogene
Target Background
This gene encodes a guanine nucleotide exchange factor that interacts specifically with the GTP-bound Rac1 and plays a role in the Rho/Rac signaling pathways. A variant in this gene was associated with osteoarthritis. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
