Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCFD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-146 of human MCFD2 (NP_644808.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MCFD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-146 of human MCFD2 (NP_644808.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01463A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCFD2 |
| Target Synonyms | F5F8D; SDNSF; F5F8D2; LMAN1IP; MCFD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A375, Mouse liver, Rat kidney, SW480 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 27-146 of human MCFD2 (NP_644808.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ | Uniprot ID | Q8NI22 |
Uniprot Id
Q8NI22
Target Species
Human
Target Name
MCFD2
Target Full Name
Multiple coagulation factor deficiency protein 2
Target Function
The MCFD2-LMAN1 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins. Plays a role in the secretion of coagulation factors.
Target Involvement
Factor V and factor VIII combined deficiency 2 (F5F8D2)
Target Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment. Endoplasmic reticulum. Golgi apparatus.
Target Synonyms
1810021C21Rik; DKFZp686G21263; F5F8D; LMAN1IP; MCFD 2; Mcfd2; MCFD2_HUMAN; Multiple coagulation factor deficiency protein 2; Neural stem cell derived neuronal survival protein; Neural stem cell-derived neuronal survival protein; SDNSF
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
