Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCHR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human MCHR1 (NP_005288.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MCHR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human MCHR1 (NP_005288.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07198A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCHR1 |
| Target Synonyms | SLC1; GPR24; MCH1R; SLC-1; MCH-1R; MCHR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human MCHR1 (NP_005288.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTS | Uniprot ID | Q99705 |
Uniprot Id
Q99705
Target Species
Human
Target Name
MCHR1
Target Full Name
Melanin-concentrating hormone receptor 1
Target Function
Receptor for melanin-concentrating hormone, coupled to both G proteins that inhibit adenylyl cyclase and G proteins that activate phosphoinositide hydrolysis.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Highest level in brain, particularly in the frontal cortex and hypothalamus, lower levels in the liver and heart.
Target Synonyms
MCHR1; GPR24; SLC1; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR; SLC-1; Somatostatin receptor-like protein
Target Background
The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
