-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCM4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 764-863 of human MCM4 (P33991) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MCM4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 764-863 of human MCM4 (P33991) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14030A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCM4 |
| Target Synonyms | NKCD; CDC21; CDC54; IMD54; NKGCD; hCdc21; P1-CDC21; MCM4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, PC-12, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 764-863 of human MCM4 (P33991). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVRLL | Uniprot ID | P33991 |
Uniprot Id
P33991
Target Species
Human
Target Name
MCM4
Target Full Name
DNA replication licensing factor MCM4
Target Function
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
Target Involvement
Natural killer cell and glucocorticoid deficiency with DNA repair defect (NKGCD)
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
MCM family
Target Synonyms
19G; AI325074; AU045576; CDC 21; CDC 54; CDC21; CDC21 homolog; CDC21, S. pombe, homolog of; CDC54; Cell division cycle 21, S. pombe, homolog of; DNA replication licensing factor MCM 4; DNA replication licensing factor MCM4; hCdc 21; hCdc21; Homolog of S. pombe cell devision cycle 21; KIAA4003; mcdc21; MCM 4; MCM 4 minichromosome maintenance deficient 4; mcm4; MCM4 minichromosome maintenance deficient 4; MCM4 minichromosome maintenance deficient 4, mitotin (S. cerevisiae); MCM4_HUMAN; Mcmd4; MGC33310; Minichromosome maintenance 4; Minichromosome maintenance complex component 4; Minichromosome maintenance deficient (S. cerevisiae) 4; Minichromosome maintenance deficient 4; Minichromosome maintenance deficient 4 homolog (S. cerevisiae); Minichromosome maintenance, S. cerevisiae, homolog of, 4; mKIAA4003; NKCD; NKGCD; P1 CDC21; P1-CDC21; P1CDC21
Target Background
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.
Notification