Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCT4/SLC16A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-465 of human MCT4/SLC16A3 (NP_004198.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MCT4/SLC16A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 410-465 of human MCT4/SLC16A3 (NP_004198.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11724A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCT4/SLC16A3 |
| Target Synonyms | MCT3; MCT4; MCT 3; MCT 4; MCT-3; MCT-4; MCT4/SLC16A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HeLa2, Rat skeletal muscle, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 410-465 of human MCT4/SLC16A3 (NP_004198.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV | Uniprot ID | O15427 |
Uniprot Id
O15427
Target Species
Human
Target Name
SLC16A3
Target Full Name
Monocarboxylate transporter 4
Target Function
Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Monocarboxylate porter (TC 2.A.1.13) family
Target Tissue Specificity
Highly expressed in skeletal muscle.
Target Research Area
Cancer
Target Synonyms
MCT 4; MCT3; MCT4; Monocarboxylate transporter 3; Monocarboxylate transporter 4; MOT4_HUMAN; SLC16A3; Solute carrier family 16 member 3
Target Background
Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family-16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. The MCTs, which include MCT1 (SLC16A1; MIM 600682) and MCT2 (SLC16A7; MIM 603654), are characterized by 12 predicted transmembrane domains (Price et al., 1998 [PubMed 9425115]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
