-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCTS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human MCTS1 (NP_054779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MCTS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human MCTS1 (NP_054779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10876A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCTS1 |
| Target Synonyms | MCT1; MCT-1; MCTS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human MCTS1 (NP_054779.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK | Uniprot ID | Q9ULC4 |
Uniprot Id
Q9ULC4
Target Species
Human
Target Name
MCTS1
Target Full Name
Malignant T-cell-amplified sequence 1
Target Function
Anti-oncogene that plays a role in cell cycle regulation; decreases cell doubling time and anchorage-dependent growth; shortens the duration of G1 transit time and G1/S transition. When constitutively expressed, increases CDK4 and CDK6 kinases activity and CCND1/cyclin D1 protein level, as well as G1 cyclin/CDK complex formation. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role as translation enhancer; recruits the density-regulated protein/DENR and binds to the cap complex of the 5'-terminus of mRNAs, subsequently altering the mRNA translation profile; up-regulates protein levels of BCL2L2, TFDP1, MRE11, CCND1 and E2F1, while mRNA levels remains constant. Hyperactivates DNA damage signaling pathway; increased gamma-irradiation-induced phosphorylation of histone H2AX, and induces damage foci formation. Increases the overall number of chromosomal abnormalities such as larger chromosomes formation and multiple chromosomal fusions when overexpressed in gamma-irradiated cells. May play a role in promoting lymphoid tumor development: lymphoid cell lines overexpressing MCTS1 exhibit increased growth rates and display increased protection against apoptosis. May contribute to the pathogenesis and progression of breast cancer via promotion of angiogenesis through the decline of inhibitory THBS1/thrombospondin-1, and inhibition of apoptosis. Involved in the process of proteasome degradation to down-regulate Tumor suppressor p53/TP53 in breast cancer cell; Positively regulates phosphorylation of MAPK1 and MAPK3. Involved in translation initiation; promotes aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits.
Target Subcellular Location
Cytoplasm. Note=Nuclear relocalization after DNA damage.
Target Protein Families
MCTS1 family
Target Tissue Specificity
Ubiquitous. Over-expressed in T-cell lymphoid cell lines and in non-Hodgkin lymphoma cell lines as well as in a subset of primary large B-cell lymphomas.
Target Research Area
Cell Cycle
Target Synonyms
FLJ39637; Malignant T cell amplified sequence 1; Malignant T cell-amplified sequence 1; MCT 1; MCT-1; MCT1; MCTS 1; MCTS1; MCTS1_HUMAN; Multiple copies T cell malignancies 1; Multiple copies T cell malignancies; Multiple copies T-cell malignancies; Oncogene MCT 1; Oncogene MCT1
Target Background
Predicted to enable translation initiation factor activity. Involved in IRES-dependent viral translational initiation; formation of translation preinitiation complex; and ribosome disassembly. Located in cytosol and plasma membrane. Colocalizes with cytosolic small ribosomal subunit.
Notification