-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCU was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 51-170 of human MCU (NP_612366.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MCU was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 51-170 of human MCU (NP_612366.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17188A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCU |
| Target Synonyms | HsMCU; C10orf42; CCDC109A; CU | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, 293T, Mouse spleen, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 51-170 of human MCU (NP_612366.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH | Uniprot ID | Q8NE86 |
Uniprot Id
Q8NE86
Target Species
Human
Target Name
MCU
Target Full Name
Calcium uniporter protein, mitochondrial
Target Function
Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria. Constitutes the pore-forming and calcium-conducting subunit of the uniporter complex (uniplex). Activity is regulated by MICU1 and MICU2. At low Ca(2+) levels MCU activity is down-regulated by MICU1 and MICU2; at higher Ca(2+) levels MICU1 increases MCU activity. Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways. Involved in buffering the amplitude of systolic calcium rises in cardiomyocytes. While dispensable for baseline homeostatic cardiac function, acts as a key regulator of short-term mitochondrial calcium loading underlying a 'fight-or-flight' response during acute stress: acts by mediating a rapid increase of mitochondrial calcium in pacemaker cells. participates in mitochondrial permeability transition during ischemia-reperfusion injury. Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake. Mitochondrial calcium uptake in skeletal muscle cells is involved in muscle size in adults. Regulates synaptic vesicle endocytosis kinetics in central nerve terminal. Involved in antigen processing and presentation.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
MCU (TC 1.A.77) family
Target Synonyms
MCU; C10orf42; CCDC109A; Calcium uniporter protein, mitochondrial; HsMCU; Coiled-coil domain-containing protein 109A
Target Background
Enables calcium channel activity; identical protein binding activity; and uniporter activity. Involved in several processes, including positive regulation of mitochondrial calcium ion concentration; positive regulation of mitochondrial fission; and positive regulation of neutrophil chemotaxis. Acts upstream of or within calcium import into the mitochondrion. Located in mitochondrial inner membrane. Is integral component of mitochondrial inner membrane. Part of uniplex complex.
Notification