-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MDH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 235-334 of human MDH1 (P40925) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MDH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 235-334 of human MDH1 (P40925) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14186A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MDH1 |
| Target Synonyms | KAR; MDHA; MOR2; DEE88; MDH-s; EIEE88; HEL-S-32; MGC:1375; MDH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, Jurkat, Mouse brain, Mouse liver, Rat kidney, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 235-334 of human MDH1 (P40925). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA | Uniprot ID | P40925 |
Uniprot Id
P40925
Target Species
Human
Target Name
MDH1
Target Full Name
Malate dehydrogenase, cytoplasmic
Target Function
Catalyzes the reduction of aromatic alpha-keto acids in the presence of NADH. Plays essential roles in the malate-aspartate shuttle and the tricarboxylic acid cycle, important in mitochondrial NADH supply for oxidative phosphorylation.
Target Subcellular Location
Cytoplasm.
Target Protein Families
LDH/MDH superfamily, MDH type 2 family
Target Research Area
Metabolism
Target Synonyms
cytoplasmic; Cytosolic malate dehydrogenase; Diiodophenylpyruvate reductase; Malate dehydrogenase 1, NAD (soluble); Malate dehydrogenase; Malate dehydrogenase cytoplasmic; MDH s; mdh1; MDHA; MDHC_HUMAN; MDHs; MGC:1375; MOR2; Soluble malate dehydrogenase
Target Background
This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6.
Notification