Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ME3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 505-604 of human ME3 (NP_001014811.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ME3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 505-604 of human ME3 (NP_001014811.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04835A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ME3 |
| Target Synonyms | NADP-ME; ME3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat brain, Rat heart, 293T, HT-29, Mouse brain, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 505-604 of human ME3 (NP_001014811.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV | Uniprot ID | Q16798 |
Uniprot Id
Q16798
Target Species
Human
Target Name
ME3
Target Full Name
NADP-dependent malic enzyme, mitochondrial
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Malic enzymes family
Target Tissue Specificity
Expressed predominantly in organs with a low-division rate.
Target Research Area
others
Target Synonyms
ME3NADP-dependent malic enzyme; mitochondrial; NADP-ME; EC 1.1.1.40; Malic enzyme 3
Target Background
Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
