-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MED14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-650 of human MED14 (NP_004220.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MED14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-650 of human MED14 (NP_004220.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09071A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED14 |
| Target Synonyms | CSRP; RGR1; CRSP2; EXLM1; CXorf4; CRSP150; DRIP150; TRAP170; MED14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse brain, Mouse pancreas, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 470-650 of human MED14 (NP_004220.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDQATLDDMEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVESKKTKRAGEMCAFNKVLAHFVAMCDT | Uniprot ID | O60244 |
Uniprot Id
O60244
Target Species
Human
Target Name
MED14
Target Full Name
Mediator of RNA polymerase II transcription subunit 14
Target Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Target Subcellular Location
Nucleus.
Target Protein Families
Mediator complex subunit 14 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Activator-recruited cofactor 150 kDa component; ARC150; Cofactor required for Sp1 transcriptional activation subunit 2; CRSP complex subunit 2; DRIP150; EXLM1; hRGR1; MED14; MED14_HUMAN; Mediator complex subunit 14; Mediator of RNA polymerase II transcription subunit 14; RGR1; RGR1 homolog; Thyroid hormone receptor-associated protein complex 170 kDa component; Transcriptional coactivator CRSP150; Trap170; Vitamin D3 receptor-interacting protein complex 150 kDa component
Target Background
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
Notification