-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MED19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human MED19 (NP_703151.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MED19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human MED19 (NP_703151.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07142A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED19 |
| Target Synonyms | LCMR1; DT2P1G7; MED19AS; MED19 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human MED19 (NP_703151.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLP | Uniprot ID | A0JLT2 |
Uniprot Id
A0JLT2
Target Species
Human
Target Name
MED19
Target Full Name
Mediator of RNA polymerase II transcription subunit 19
Target Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Target Subcellular Location
Nucleus.
Target Protein Families
Mediator complex subunit 19 family
Target Synonyms
LCMR1; Lung cancer metastasis related protein 1; Lung cancer metastasis-related protein 1; med19; MED19_HUMAN; Mediator complex subunit 19; Mediator of RNA polymerase II transcription subunit 19
Target Background
The protein encoded by this gene is a subunit of the Mediator complex, which binds to gene-specific regulatory factors and provides support for the basal RNA polymerase II transcription machinery. This gene has been implicated in the growth of several types of cancer, and inhibition of its expression inhibits the growth and spread of these cancers. Two transcript variants encoding different isoforms have been found for this gene.
Notification