-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MED25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human MED25 (NP_112235.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MED25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human MED25 (NP_112235.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04605A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED25 |
| Target Synonyms | P78; ACID1; ARC92; BVSYS; PTOV2; CMT2B2; TCBAP0758; MED25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, K-562, Mouse brain, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human MED25 (NP_112235.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTENLVQQIGERGIHFSIVSPRKLPALRLLFEKAAP | Uniprot ID | Q71SY5 |
Uniprot Id
Q71SY5
Target Species
Human
Target Name
MED25
Target Full Name
Mediator of RNA polymerase II transcription subunit 25
Target Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for RARA/RXRA-mediated transcription.
Target Involvement
Charcot-Marie-Tooth disease 2B2 (CMT2B2); Basel-Vanagaite-Smirin-Yosef syndrome (BVSYS)
Target Subcellular Location
Nucleus.
Target Protein Families
Mediator complex subunit 25 family
Target Tissue Specificity
Ubiquitously expressed. Highest levels in brain, heart, kidney, peripheral leukocytes, placenta, skeletal muscle and spleen.
Target Synonyms
ACID1; Activator interaction domain 1 protein; Activator interaction domain-containing protein 1; Activator-recruited cofactor 92 kDa component; ARC/mediator transcriptional coactivator subunit ; ARC/mediator transcriptional coactivator subunit ARC92; ARC92; BVSYS; CMT2B2; DKFZp434K0512; FLJ10193; med25; MED25 protein; MED25_HUMAN; Mediator complex subunit 25; Mediator of RNA polymerase II transcription subunit 25; Mediator of RNA polymerase II transcription; subunit 25 homolog (S cerevisiae); Mediator of RNA polymerase II transcription; subunit 25 homolog (yeast); MGC70671; p78; prostate-derived protein 78 kDa; PTOV2; TCBAP0758
Target Background
This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
Notification