-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MED26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-574 of human MED26 (NP_004822.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MED26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-574 of human MED26 (NP_004822.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07474A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED26 |
| Target Synonyms | CRSP7; CRSP70; MED26 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spinal cord, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-574 of human MED26 (NP_004822.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWY | Uniprot ID | O95402 |
Uniprot Id
O95402
Target Species
Human
Target Name
MED26
Target Full Name
Mediator of RNA polymerase II transcription subunit 26
Target Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors.
Target Subcellular Location
Nucleus.
Target Protein Families
Mediator complex subunit 26 family
Target Synonyms
Activator recruited cofactor 70 kDa component; Activator-recruited cofactor 70 kDa component; ARC 70; ARC70; Cofactor required for Sp1 transcriptional activation subunit 7; Cofactor required for Sp1 transcriptional activation, subunit 7 (70kD); Cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa; CRSP 7; CRSP complex subunit 7; CRSP70; MED 26; Med26; MED26_HUMAN; Mediator complex subunit 26; Mediator of RNA polymerase II transcription subunit 26; Transcriptional coactivator CRSP70
Target Background
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Notification