Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1000-1170 of human MEI1 (NP_689726.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1000-1170 of human MEI1 (NP_689726.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04587A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEI1 |
| Target Synonyms | HYDM3; SPATA38; MEI1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1000-1170 of human MEI1 (NP_689726.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRP | Uniprot ID | Q5TIA1 |
Uniprot Id
Q5TIA1
Target Species
Human
Target Name
MEI1
Target Full Name
Meiosis inhibitor protein 1
Target Function
Required for normal meiotic chromosome synapsis. May be involved in the formation of meiotic double-strand breaks (DSBs) in spermatocytes.
Target Tissue Specificity
Expressed predominantly in testis. Weakly expressed in spleen and thymus. Expressed in the ovaries, Fallopian tubes and uterus.
Target Synonyms
MEI1Meiosis inhibitor protein 1; Meiosis defective protein 1
Target Background
Predicted to be involved in meiosis I. Predicted to act upstream of or within gamete generation; meiotic spindle organization; and meiotic telomere clustering. Implicated in gestational trophoblastic neoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
