Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEIS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 325-375 of human MEIS3 (NP_001287988.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEIS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 325-375 of human MEIS3 (NP_001287988.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07523A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEIS3 |
| Target Synonyms | MRG2; MEIS3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 325-375 of human MEIS3 (NP_001287988.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL | Uniprot ID | Q99687 |
Uniprot Id
Q99687
Target Species
Human
Target Name
MEIS3
Target Full Name
Homeobox protein Meis3
Target Function
Transcriptional regulator which directly modulates PDPK1 expression, thus promoting survival of pancreatic beta-cells. Also regulates expression of NDFIP1, BNIP3, and CCNG1.
Target Subcellular Location
Nucleus.
Target Protein Families
TALE/MEIS homeobox family
Target Research Area
Transcription
Target Synonyms
Homeobox protein meis3; Meis homeobox 3; Meis1 myeloid ecotropic viral integration site 1 homolog 3; Meis1 related protein 2 ; Meis1-related protein 2; meis3; MEIS3_HUMAN; MRG2
Target Background
This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
