-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEK5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MEK5 (NP_660143.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MEK5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MEK5 (NP_660143.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09403A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEK5 |
| Target Synonyms | MEK5; MAPKK5; PRKMK5; HsT17454 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, Mouse liver, NCI-H460, Rat kidney, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MEK5 (NP_660143.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGK | Uniprot ID | Q13163 |
Uniprot Id
Q13163
Target Species
Human
Target Name
MAP2K5
Target Full Name
Dual specificity mitogen-activated protein kinase kinase 5
Target Function
Acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appears to play a critical role in protecting cells from stress-induced apoptosis, neuronal survival and cardiac development and angiogenesis.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily
Target Tissue Specificity
Expressed in many adult tissues. Abundant in heart and skeletal muscle.
Target Synonyms
Dual specificity mitogen activated protein kinase kinase 5; Dual specificity mitogen-activated protein kinase kinase 5; EC 2.7.12.2; HsT17454; MAP kinase kinase 5; MAP kinase kinase MEK5b; MAP2K5; MAPK/ERK kinase 5; MAPKK 5; MAPKK5; MEK 5; mitogen-activated protein kinase kinase 5; MKK5; MP2K5_HUMAN; PRKMK5; Protein kinase, mitogen-activated, kinase 5; SAPKK5; SKK5
Target Background
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been described.
Notification