-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEK7 was raised in Rabbit using the recombinant protein of human MEK7 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MEK7 was raised in Rabbit using the recombinant protein of human MEK7 as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08063A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEK7 |
| Target Synonyms | MEK; MKK7; JNKK2; MEK 7; MAPKK7; PRKMK7; SAPKK4; SAPKK-4; MEK7 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant protein of human MEK7. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR | Uniprot ID | O14733 |
Uniprot Id
O14733
Target Species
Human
Target Name
MAP2K7
Target Full Name
Dual specificity mitogen-activated protein kinase kinase 7
Target Function
Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K4/MKK4, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4/MKK4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The monophosphorylation of JNKs on the Thr residue is sufficient to increase JNK activity indicating that MAP2K7/MKK7 is important to trigger JNK activity, while the additional phosphorylation of the Tyr residue by MAP2K4/MKK4 ensures optimal JNK activation. Has a specific role in JNK signal transduction pathway activated by proinflammatory cytokines. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Part of a non-canonical MAPK signaling pathway, composed of the upstream MAP3K12 kinase and downstream MAP kinases MAPK1/ERK2 and MAPK3/ERK1, that enhances the AP-1-mediated transcription of APP in response to APOE.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily
Target Tissue Specificity
Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle.
Target Synonyms
c-Jun N-terminal kinase kinase 2; Dual specificity mitogen activated protein kinase kinase 7; Dual specificity mitogen-activated protein kinase kinase 7; JNK activating kinase 2; JNK kinase 2; JNK-activating kinase 2; JNKK 2; Jnkk-2; Jnkk2; MAP kinase kinase 7; MAP2K7; MAPK/ERK kinase 7; MAPKK 7; MAPKK-7; MAPKK7; MEK 7; Mitogen Activated Protein Kinase kinase 7; MKK 7; MKK-7; MKK7; MP2K7_HUMAN; PRKMK 7; PRKMK-7; PRKMK7; SAPK kinase 4; SAPKK-4; SAPKK4; Sek 2; Sek-2; Sek2; SKK4; stress-activated protein kinase kinase 4
Target Background
The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2, MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Alternative splicing results in multiple transcript variants.
Notification