Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEKK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK2 (Q9Y2U5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MEKK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK2 (Q9Y2U5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14251A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEKK2 |
| Target Synonyms | MEKK2; MEKK2B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MCF7, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK2 (Q9Y2U5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLD | Uniprot ID | Q9Y2U5 |
Uniprot Id
Q9Y2U5
Target Species
Human
Target Name
MAP3K2
Target Full Name
Mitogen-activated protein kinase kinase kinase 2
Target Function
Component of a protein kinase signal transduction cascade. Regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. Plays a role in caveolae kiss-and-run dynamics.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Upon EGF stimulation, translocates into the nucleus.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Target Synonyms
M3K2_HUMAN; Map3k2; MAPK/ERK kinase kinase 2; MEK kinase 2; MEKK 2; MEKK2b; Mitogen activated protein kinase kinase kinase 2 ; Mitogen-activated protein kinase kinase kinase 2
Target Background
The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
