Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEKK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human MEKK2 (NP_006600.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEKK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human MEKK2 (NP_006600.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05254A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEKK2 |
| Target Synonyms | MEKK2; MEKK2B | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human MEKK2 (NP_006600.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARN | Uniprot ID | Q9Y2U5 |
Uniprot Id
Q9Y2U5
Target Species
Human
Target Name
MAP3K2
Target Full Name
Mitogen-activated protein kinase kinase kinase 2
Target Function
Component of a protein kinase signal transduction cascade. Regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. Plays a role in caveolae kiss-and-run dynamics.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Upon EGF stimulation, translocates into the nucleus.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Target Synonyms
M3K2_HUMAN; Map3k2; MAPK/ERK kinase kinase 2; MEK kinase 2; MEKK 2; MEKK2b; Mitogen activated protein kinase kinase kinase 2 ; Mitogen-activated protein kinase kinase kinase 2
Target Background
The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
