Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Melan-A/MART-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 11-110 of human MLANA (NP_005502.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Melan-A/MART-1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 11-110 of human MLANA (NP_005502.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14835A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Melan-A/MART-1 |
| Target Synonyms | MART1; MART-1; Melan-A/MART-1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SK-MEL-28 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 11-110 of human MLANA (NP_005502.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLLLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP | Uniprot ID | Q16655 |
Uniprot Id
Q16655
Target Species
Human
Target Name
MLANA
Target Full Name
Melanoma antigen recognized by T-cells 1
Target Function
Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type III membrane protein. Golgi apparatus. Golgi apparatus, trans-Golgi network membrane. Melanosome. Note=Also found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation.
Target Tissue Specificity
Expression is restricted to melanoma and melanocyte cell lines and retina.
Target Research Area
Cancer
Target Synonyms
Antigen LB39 AA; Antigen LB39-AA; Antigen SK29 AA; Antigen SK29-AA; MAR1_HUMAN; MART 1; MART-1; MART1; Melan A; Melan A protein; Melanoma antigen recognized by T cells 1; Melanoma antigen recognized by T-cells 1; MLAN A; MLANA; OTTHUMP00000021036; OTTHUMP00000021037; OTTHUMP00000021038; Protein Melan-A
Target Background
Located in endoplasmic reticulum membrane; melanosome; and trans-Golgi network.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
