Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MESP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 149-268 of human MESP1 (NP_061140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MESP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 149-268 of human MESP1 (NP_061140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06472A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MESP1 |
| Target Synonyms | bHLHc5; MESP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, A-549, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 149-268 of human MESP1 (NP_061140.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPSPLLPGDVLALLETWMPLSPLEWLPEEPK | Uniprot ID | Q9BRJ9 |
Uniprot Id
Q9BRJ9
Target Species
Human
Target Name
MESP1
Target Full Name
Mesoderm posterior protein 1
Target Function
Transcription factor. Plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. Defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.
Target Subcellular Location
Nucleus.
Target Synonyms
bHLHc5; Class C basic helix-loop-helix protein 5; Mesoderm posterior 1; Mesoderm posterior 1 homolog (mouse); Mesoderm posterior 1 homolog; Mesoderm posterior protein 1; MESP 1; Mesp1; MESP1_HUMAN; MGC10676; MGC159208; MGC159210; OTTMUSP00000030151
Target Background
Enables DNA-binding transcription factor activity and transcription cis-regulatory region binding activity. Involved in several processes, including endothelial cell differentiation; heart development; and positive regulation of transcription by RNA polymerase II. Predicted to be part of chromatin. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
