Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against METTL13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-699 of human METTL13 (NP_057019.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against METTL13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-699 of human METTL13 (NP_057019.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02679A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | METTL13 |
| Target Synonyms | feat; DFNM1; CGI-01; DFNB26; DFNB26M; KIAA0859; EEF1AKNMT; 5630401D24Rik; METTL13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, HepG2, K-562, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 540-699 of human METTL13 (NP_057019.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV | Uniprot ID | Q8N6R0 |
Uniprot Id
Q8N6R0
Target Species
Human
Target Name
METTL13
Target Full Name
eEF1A lysine and N-terminal methyltransferase
Target Function
Dual methyltransferase that catalyzes methylation of elongation factor 1-alpha (EEF1A1 and EEF1A2) at two different positions, and is therefore involved in the regulation of mRNA translation. Via its C-terminus, methylates EEF1A1 and EEF1A2 at the N-terminal residue 'Gly-2'. Via its N-terminus dimethylates EEF1A1 and EEF1A2 at residue 'Lys-55'. Has no activity towards core histones H2A, H2B, H3 and H4. Negatively regulates cell proliferation at G1/S transition via transcriptional suppression of cell cycle regulatory genes such as CDK4 and CDK6.
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion.
Target Protein Families
Methyltransferase superfamily
Target Synonyms
5630401D24Rik; CGI-01; MET13_HUMAN; Methyltransferase-like protein 13; Mettl13
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
