-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEX3C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 484-659 of human MEX3C (NP_057710.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MEX3C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 484-659 of human MEX3C (NP_057710.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06837A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEX3C |
| Target Synonyms | RKHD2; BM-013; MEX-3C; RNF194; MEX3C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 484-659 of human MEX3C (NP_057710.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS | Uniprot ID | Q5U5Q3 |
Uniprot Id
Q5U5Q3
Target Species
Human
Target Name
MEX3C
Target Full Name
RNA-binding E3 ubiquitin-protein ligase MEX3C
Target Function
E3 ubiquitin ligase responsible for the post-transcriptional regulation of common HLA-A allotypes. Binds to the 3' UTR of HLA-A2 mRNA, and regulates its levels by promoting mRNA decay. RNA binding is sufficient to prevent translation, but ubiquitin ligase activity is required for mRNA degradation.
Target Involvement
Genetic variations in MEX3C may be associated with susceptibility to essential hypertension.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Predominantly expressed in the cytoplasm and shuttles between the cytoplasm and the nucleus through the CRM1 export pathway. May act as suppressor of replication stress and chromosome missegregation.
Target Tissue Specificity
Highest levels found in fetal brain and testis. Also expressed in thymus, salivary gland and uterus. Highly expressed in cells of the innate immune system, in particular activated NK cells. Week expression in the intestine.
Target Synonyms
BM 013; BM013; FLJ38871; Mex 3 homolog C C. elegans ; Mex 3, C. elegans, homolog of C; MEX 3C; MEX3C; MEX3C_HUMAN; Ring finger and KH domain containing 2 ; RING finger and KH domain containing protein 2; RING finger and KH domain-containing protein 2; RING finger protein 194; RKHD2; RNA-binding E3 ubiquitin-protein ligase MEX3C; RNA-binding protein MEX3C; RNF194
Notification