Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MFSD2A was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 464-543 of human MFSD2A (NP_001129965.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MFSD2A was raised in Rabbit using the recombinant fusion protein containing a sequence within amino acids 464-543 of human MFSD2A (NP_001129965.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07971A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MFSD2A |
| Target Synonyms | NLS1; MFSD2; MCPH15; SLC59A1; HsMFSD2A; NEDMISBA; MFSD2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence within amino acids 464-543 of human MFSD2A (NP_001129965.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFAGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL | Uniprot ID | Q8NA29 |
Uniprot Id
Q8NA29
Target Species
Human
Target Name
MFSD2A
Target Full Name
Sodium-dependent lysophosphatidylcholine symporter 1
Target Function
Sodium-dependent lysophosphatidylcholine (LPC) symporter, which plays an essential role for blood-brain barrier formation and function. Specifically expressed in endothelium of the blood-brain barrier of micro-vessels and transports LPC into the brain. Transport of LPC is essential because it constitutes the major mechanism by which docosahexaenoic acid (DHA), an omega-3 fatty acid that is essential for normal brain growth and cognitive function, enters the brain. Transports LPC carrying long-chain fatty acids such LPC oleate and LPC palmitate with a minimum acyl chain length of 14 carbons. Does not transport docosahexaenoic acid in unesterified fatty acid. Specifically required for blood-brain barrier formation and function, probably by mediating lipid transport. Not required for central nervous system vascular morphogenesis. Acts as a transporter for tunicamycin, an inhibitor of asparagine-linked glycosylation. In placenta, acts as a receptor for ERVFRD-1/syncytin-2 and is required for trophoblast fusion.
Target Involvement
Microcephaly 15, primary, autosomal recessive (MCPH15)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily
Target Tissue Specificity
In placenta, associated with trophoblast cells.
Target Synonyms
1700018O18Rik; FLJ14490; FLJ35904; Major facilitator superfamily domain containing 2; Major facilitator superfamily domain containing 2A; Major facilitator superfamily domain-containing protein 2A; MFS2A_HUMAN; MFSD2; MFSD2A; RGD1310174; RP23-121J14.3
Target Background
The protein encoded by this gene is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. The encoded protein is involved in the establishment of the blood-brain barrier and is required for brain growth and function. Defects in this gene are a cause of a progressive microcephaly syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
