-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MGAT4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 409-548 of human MGAT4B (NP_055090.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MGAT4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 409-548 of human MGAT4B (NP_055090.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03251A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MGAT4B |
| Target Synonyms | GNT-IV; GNT-IVB; MGAT4B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 409-548 of human MGAT4B (NP_055090.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILSEIFLKKAD | Uniprot ID | Q9UQ53 |
Uniprot Id
Q9UQ53
Target Species
Human
Target Name
MGAT4B
Target Full Name
Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
Target Function
Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Glycosyltransferase 54 family
Target Tissue Specificity
Widely expressed. Strongly overexpressed in pancreatic cancer.
Target Synonyms
3-D-mannoside beta-1; 3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B; 4-N-acetylglucosaminyltransferase IVb; Alpha 1 3 mannosyl glycoprotein beta 1 4 N acetylglucosaminyltransferase; Alpha-1; Aminyltransferase; GlcNAc T IVb; GlcNAc-T IVb; GNT IV; GNT IVB; GnT-IVb; GNTIV; GNTIVB; Mannosyl (alpha 1 3) glycoprotein beta 1 4 N acetylglucosaminyltransferase isozyme B; MGAT 4B; mgat4b; MGT4B_HUMAN; N acetylglucosaminyltransferase IVb; N glycosyl oligosaccharide glycoprotein; N glycosyl oligosaccharide glycoprotein N acetylglucosaminyltransferase IVb; N-acetylglucosaminyltransferase IVb; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb; UDP N acetylglucosamine alpha 1 3 D mannoside beta 1 4 N acetylglucosaminyltransferase IV; UDP N acetylglucosamine alpha 1 3 D mannoside beta 1 4 N acetylglucosaminyltransferase IVb; UDP-N-acetylglucosamine: alpha-1
Target Background
This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme A, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1, 4 linkage to the Man-alpha-1, 3-Man-beta-1, 4-GlcNAc arm of R-Man-alpha-1, 6(GlcNAc-beta-1, 2-Man-alpha-1, 3)Man-beta-1, 4-GlcNAc-beta-1, 4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation.
Notification