-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MIB1/DIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MIB1/DIP1 (Q86YT6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MIB1/DIP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MIB1/DIP1 (Q86YT6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14131A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MIB1/DIP1 |
| Target Synonyms | MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2; MIB1/DIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, K-562, Mouse brain, Mouse lung, Mouse testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MIB1/DIP1 (Q86YT6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKC | Uniprot ID | Q86YT6 |
Uniprot Id
Q86YT6
Target Species
Human
Target Name
MIB1
Target Full Name
E3 ubiquitin-protein ligase MIB1
Target Function
E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis. Involved in ubiquitination of centriolar satellite CEP131, CEP290 and PCM1 proteins and hence inhibits primary cilium formation in proliferating cells. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation.
Target Involvement
Left ventricular non-compaction 7 (LVNC7)
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Cell membrane.
Target Tissue Specificity
Widely expressed at low level. Expressed at higher level in spinal cord, ovary, whole brain, and all specific brain regions examined.
Target Research Area
Signal Transduction
Target Synonyms
DAPK-interacting protein 1; Dip 1; DIP-1; Dip1; E3 ubiquitin protein ligase MIB 1; E3 ubiquitin protein ligase MIB1; E3 ubiquitin-protein ligase mib1; KIAA1323; LVNC7; MIB; mib1; MIB1_HUMAN; Mind bomb homolog 1; Mindbomb E3 ubiquitin protein ligase 1; Ubiquitin ligase mind bomb; Zinc finger ZZ type with ankyrin repeat domain protein 2; ZZANK2; ZZZ6
Target Background
This gene encodes a protein containing multiple ankyrin repeats and RING finger domains that functions as an E3 ubiquitin ligase. The encoded protein positively regulates Notch signaling by ubiquitinating the Notch receptors, thereby facilitating their endocytosis. This protein may also promote the ubiquitination and degradation of death-associated protein kinase 1 (DAPK1).
Notification