Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MICB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-108 of human MICB (NP_005922.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MICB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-108 of human MICB (NP_005922.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00930A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MICB |
| Target Synonyms | PERB11.2; MICB | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NCI-H460, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-108 of human MICB (NP_005922.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKG | Uniprot ID | Q29980 |
Uniprot Id
Q29980
Target Species
Human
Target Name
MICB
Target Full Name
MHC class I polypeptide-related sequence B
Target Function
Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.
Target Involvement
Rheumatoid arthritis (RA)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
MHC class I family, MIC subfamily
Target Tissue Specificity
Widely expressed with the exception of the central nervous system where it is absent. Expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In hepatocellular carcinomas, expressed in tumor cells but not in s
Target Synonyms
MHC class I chain related protein B; MHC class I chain related protein B2; MHC class I like molecule PERB11.2 IMX; MHC class I mic B antigen; MHC class I polypeptide related sequence B; MHC class I polypeptide-related sequence B; MIC B; MIC-B; MICB; MICB_HUMAN; PERB11.2; Stress inducible class I homolog
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
