-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MICU1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-255 of human MICU1 (NP_001182447.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MICU1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 105-255 of human MICU1 (NP_001182447.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03657A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MICU1 |
| Target Synonyms | CALC; EFHA3; MPXPS; CBARA1; ara CALC; MICU1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 105-255 of human MICU1 (NP_001182447.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTS | Uniprot ID | Q9BPX6 |
Uniprot Id
Q9BPX6
Target Species
Human
Target Name
MICU1
Target Full Name
Calcium uptake protein 1, mitochondrial
Target Function
Key regulator of mitochondrial calcium uniporter (MCU) that senses calcium level via its EF-hand domains. MICU1 and MICU2 form a disulfide-linked heterodimer that stimulates and inhibits MCU activity, depending on the concentration of calcium. MICU1 acts both as an activator or inhibitor of mitochondrial calcium uptake. Acts as a gatekeeper of MCU at low concentration of calcium, preventing channel opening. Enhances MCU opening at high calcium concentration, allowing a rapid response of mitochondria to calcium signals generated in the cytoplasm. Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake. Induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG.
Target Involvement
Myopathy with extrapyramidal signs (MPXPS)
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion intermembrane space.
Target Protein Families
MICU1 family, MICU1 subfamily
Target Tissue Specificity
Expressed in epithelial cell lines. Strongly expressed in epidermal keratinocytes and dermal endothelial cells.
Target Synonyms
Allergen Hom s 4; ara CALC; atopy related autoantigen ; atopy related autoantigen CALC ; Atopy-related autoantigen CALC; CALC; calcium binding atopy related autoantigen 1; Calcium uptake protein 1; calcium uptake protein 1, mitochondrial ; Calcium-binding atopy-related autoantigen 1; CBARA1; EFHA3; FLJ12684; MICU1; MICU1_HUMAN; mitochondrial; mitochondrial calcium uptake 1 ; MPXPS
Target Background
This gene encodes an essential regulator of mitochondrial Ca2+ uptake under basal conditions. The encoded protein interacts with the mitochondrial calcium uniporter, a mitochondrial inner membrane Ca2+ channel, and is essential in preventing mitochondrial Ca2+ overload, which can cause excessive production of reactive oxygen species and cell stress. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification