-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MIEN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIEN1 (NP_115715.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MIEN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIEN1 (NP_115715.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00590A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MIEN1 |
| Target Synonyms | C35; ORB3; XTP4; RDX12; C17orf37; MIEN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human MIEN1 (NP_115715.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL | Uniprot ID | Q9BRT3 |
Uniprot Id
Q9BRT3
Target Species
Human
Target Name
MIEN1
Target Full Name
Migration and invasion enhancer 1
Target Function
Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.
Target Subcellular Location
Cytoplasm, cytosol. Cell membrane; Lipid-anchor; Cytoplasmic side. Note=Concentrates at the leading edge of migrating cells. Localizes outside membrane raft regions.
Target Protein Families
SelWTH family
Target Tissue Specificity
Among normal tissues, present only in Leydig cells. Strongly up-regulated in breast cancers and in brain cancer distant metastasis (at protein level). Up-regulated in prostate cancer cells and in the higher grades of prostate adenocarcinoma (at protein le
Target Synonyms
C17orf37; C17orf37 homolog; C35; chromosome 17 open reading frame 37 ; HBV X transactivated gene 4 protein; HBV X-transactivated gene 4 protein; HBV XAg transactivated protein 4; HBV XAg-transactivated protein 4; MGC14832; Mien1; MIEN1_HUMAN; Migration and invasion enhancer 1; ORB3; Protein C17orf37; Protein C35; RDX12; Redox protein, 12-KD; XTP4
Target Background
Involved in negative regulation of apoptotic process; positive regulation of cell migration; and positive regulation of filopodium assembly. Located in several cellular components, including centriolar satellite; cytosol; and nucleoplasm. Is intrinsic component of the cytoplasmic side of the plasma membrane.
Notification