Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MIER1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-160 of human MIER1 (Q8N108) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MIER1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-160 of human MIER1 (Q8N108) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06408A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MIER1 |
| Target Synonyms | ER1; MI-ER1; MIER1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-160 of human MIER1 (Q8N108). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNS | Uniprot ID | Q8N108 |
Uniprot Id
Q8N108
Target Species
Human
Target Name
MIER1
Target Full Name
Mesoderm induction early response protein 1
Target Function
Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.
Target Subcellular Location
[Isoform 1]: Nucleus.; [Isoform 2]: Nucleus.; [Isoform 3]: Nucleus.; [Isoform 4]: Cytoplasm.; [Isoform 5]: Cytoplasm.; [Isoform 6]: Cytoplasm.
Target Tissue Specificity
Ubiquitously expressed, but at very low levels. However, consistent level of expression are observed in heart, testis, thyroid, ovary and adrenal gland. Transcripts are up-regulated in breast carcinoma cell lines and tumor.
Target Synonyms
MIER1; KIAA1610; Mesoderm induction early response protein 1; Early response 1; Er1; Mi-er1; hMi-er1
Target Background
This gene encodes a protein that was first identified in Xenopus laevis by its role in a mesoderm induction early response (MIER). The encoded protein functions as a transcriptional regulator. Alternatively spliced transcript variants encode multiple isoforms, some of which lack a C-terminal nuclear localization signal.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
