-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MIF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-115 of human MIF (NP_002406.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MIF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-115 of human MIF (NP_002406.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14707A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Mif |
| Target Synonyms | GIF; GLIF; MMIF; IF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, HL-60, Mouse brain, Mouse thymus, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-115 of human MIF (NP_002406.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA | Uniprot ID | P14174 |
Uniprot Id
P14174
Target Species
Human
Target Name
MIF
Target Full Name
Macrophage migration inhibitory factor
Target Function
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Target Involvement
Rheumatoid arthritis systemic juvenile (RASJ)
Target Subcellular Location
Secreted. Cytoplasm.
Target Protein Families
MIF family
Target Research Area
Immunology
Target Synonyms
GIF; GLIF; Glycosylation inhibiting factor; Glycosylation-inhibiting factor; L-dopachrome isomerase; L-dopachrome tautomerase; Macrophage migration inhibitory factor (glycosylation-inhibiting factor); Macrophage migration inhibitory factor; MIF; MIF protein; MIF_HUMAN; MMIF; Phenylpyruvate tautomerase
Target Background
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.
Notification