Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MIIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 279-388 of human MIIP (NP_068752.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MIIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 279-388 of human MIIP (NP_068752.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05654A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MIIP |
| Target Synonyms | IIP45; MIIP | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 279-388 of human MIIP (NP_068752.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AHVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP | Uniprot ID | Q5JXC2 |
Uniprot Id
Q5JXC2
Target Species
Human
Target Name
MIIP
Target Full Name
Migration and invasion-inhibitory protein
Target Function
Inhibits glioma cells invasion and down-regulates adhesion- and motility-associated genes such as NFKB2 and ICAM1. Exhibits opposing effects to IGFBP2 on cell invasion.
Target Tissue Specificity
Ubiquitous. Isoform 1 is expressed in brain but underexpressed in glioma tissues, at protein level. Isoform 2 is not detected in normal organs, but is expressed in gliomas with increasing levels with glioma progression. On the contrary, at protein level,
Target Synonyms
MIIP; IIP45; Migration and invasion-inhibitory protein; IGFBP2-binding protein; Invasion-inhibitory protein 45; IIp45
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
