-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MIP (NP_036196.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MIP (NP_036196.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04248A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MIP |
| Target Synonyms | AQP0; LIM1; MP26; MIP26; CTRCT15; MIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, Mouse eye, Mouse liver, Mouse skeletal muscle, Mouse testis, Rat eye, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MIP (NP_036196.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYD | Uniprot ID | P30301 |
Uniprot Id
P30301
Target Species
Human
Target Name
MIP
Target Full Name
Lens fiber major intrinsic protein
Target Function
Water channel. Channel activity is down-regulated by CALM when cytoplasmic Ca(2+) levels are increased. May be responsible for regulating the osmolarity of the lens. Interactions between homotetramers from adjoining membranes may stabilize cell junctions in the eye lens core. Plays a role in cell-to-cell adhesion and facilitates gap junction coupling.
Target Involvement
Cataract 15, multiple types (CTRCT15)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
MIP/aquaporin (TC 1.A.8) family
Target Tissue Specificity
Expressed in the cortex and nucleus of the retina lens (at protein level). Major component of lens fiber gap junctions.
Target Research Area
Immunology
Target Synonyms
MIP; AQP0; Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26
Target Background
Major intrinsic protein is a member of the water-transporting aquaporins as well as the original member of the MIP family of channel proteins. The function of the fiber cell membrane protein encoded by this gene is undetermined, yet this protein is speculated to play a role in intracellular communication. The MIP protein is expressed in the ocular lens and is required for correct lens function. This gene has been mapped among aquaporins AQP2, AQP5, and AQP6, in a potential gene cluster at 12q13.
Notification