-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Mitofusin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mitofusin 2 (O95140) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Mitofusin 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mitofusin 2 (O95140) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-17118A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Mitofusin 2 |
| Target Synonyms | HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B; Mitofusin 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat brain, Rat heart, 293T, MCF7, Mouse brain, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mitofusin 2 (O95140). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVA | Uniprot ID | O95140 |
Uniprot Id
O95140
Target Species
Human
Target Name
MFN2
Target Full Name
Mitofusin-2
Target Function
Mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Mitochondria are highly dynamic organelles, and their morphology is determined by the equilibrium between mitochondrial fusion and fission events. Overexpression induces the formation of mitochondrial networks. Membrane clustering requires GTPase activity and may involve a major rearrangement of the coiled coil domains (Probable). Plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). Is required for PRKN recruitment to dysfunctional mitochondria. Involved in the control of unfolded protein response (UPR) upon ER stress including activation of apoptosis and autophagy during ER stress. Acts as an upstream regulator of EIF2AK3 and suppresses EIF2AK3 activation under basal conditions.
Target Involvement
Charcot-Marie-Tooth disease 2A2B (CMT2A2B); Charcot-Marie-Tooth disease 2A2A (CMT2A2A); Neuropathy, hereditary motor and sensory, 6A (HMSN6A)
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Target Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family, Mitofusin subfamily
Target Tissue Specificity
Ubiquitous; expressed at low level. Highly expressed in heart and kidney.
Target Research Area
Cancer
Target Synonyms
MFN2; CPRP1; KIAA0214; Mitofusin-2; Transmembrane GTPase MFN2
Target Background
This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.
Notification