Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLLT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1510-1680 of human MLLT4 (NP_001353249.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MLLT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1510-1680 of human MLLT4 (NP_001353249.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05814A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLLT4 |
| Target Synonyms | AF6; MLLT4; MLL-AF6; l-afadin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1510-1680 of human MLLT4 (NP_001353249.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMRKREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEA | Uniprot ID | P55196 |
Uniprot Id
P55196
Target Species
Human
Target Name
AFDN
Target Full Name
Afadin
Target Function
Belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton. May play a key role in the organization of epithelial structures of the embryonic ectoderm. Essential for the organization of adherens junctions.
Target Involvement
A chromosomal aberration involving AFDN is associated with acute leukemias. Translocation t(6;11)(q27;q23) with KMT2A/MLL1. The result is a rogue activator protein.
Target Subcellular Location
Cell junction, adherens junction.
Target Synonyms
AF6; AFAD_HUMAN; Afadin; ALL1-fused gene from chromosome 6 protein; Mllt4; Protein Af-6; Protein AF6
Target Background
This gene encodes a multi-domain protein involved in signaling and organization of cell junctions during embryogenesis. It has also been identified as the fusion partner of acute lymphoblastic leukemia (ALL-1) gene, involved in acute myeloid leukemias with t(6;11)(q27;q23) translocation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, however, not all have been fully characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
