-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MLXIPL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-175 of human MLXIPL (NP_116569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MLXIPL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 17-175 of human MLXIPL (NP_116569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12312A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MLXIPL |
| Target Synonyms | MIO; MLX; CHREBP; MONDOB; WBSCR14; WS-bHLH; bHLHd14; MLXIPL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, BT-474, HepG2, HT-29, K-562, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 17-175 of human MLXIPL (NP_116569.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIE | Uniprot ID | Q9NP71 |
Uniprot Id
Q9NP71
Target Species
Human
Target Name
MLXIPL
Target Full Name
Carbohydrate-responsive element-binding protein
Target Function
Transcriptional repressor. Binds to the canonical and non-canonical E box sequences 5'-CACGTG-3'.
Target Involvement
WBSCR14 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of WBSCR14 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in liver, heart, kidney, cerebellum and intestinal tissues.
Target Synonyms
carbohydrate response element binding protein; bHLHd14; Carbohydrate responsive element binding protein; Class D basic helix-loop-helix protein 14; MIO; MLX interacting protein like; Mlx interactor; MLX-interacting protein-like; MLXIPL; MONDOB; WBS14_HUMAN; WBSCR 14; WBSCR14; Williams Beuren syndrome chromosome region 14; Williams Beuren syndrome chromosome region 14 protein; Williams-Beuren syndrome chromosomal region 14 protein; WS basic helix loop helix leucine zipper protein; WS basic-helix-loop-helix leucine zipper protein; WS bHLH; WS-bHLH
Target Background
This gene encodes a basic helix-loop-helix leucine zipper transcription factor of the Myc/Max/Mad superfamily. This protein forms a heterodimeric complex and binds and activates, in a glucose-dependent manner, carbohydrate response element (ChoRE) motifs in the promoters of triglyceride synthesis genes. The gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants.
Notification