-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MMP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-210 of human MMP1 (NP_002412.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MMP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 93-210 of human MMP1 (NP_002412.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16828A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MMP1 |
| Target Synonyms | CLG; CLGN; MMP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-375, Mouse bone, Rat spleen, SK-OV-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 93-210 of human MMP1 (NP_002412.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY | Uniprot ID | P03956 |
Uniprot Id
P03956
Target Species
Human
Target Name
MMP1
Target Full Name
Interstitial collagenase
Target Function
Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Peptidase M10A family
Target Research Area
Developmental Biology
Target Synonyms
27 kDa interstitial collagenase; CLG; CLGN; collagenase; fibroblast; collagenase; interstitial; Fibroblast collagenase; Interstitial collagenase; Matrix metallopeptidase 1 (interstitial collagenase); Matrix metalloprotease 1; Matrix Metalloproteinase 1; Matrix metalloproteinase-1; MMP 1; MMP-1; MMP1; MMP1_HUMAN; OTTHUMP00000045866
Target Background
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification