-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MMP25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human MMP25 (NP_071913.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MMP25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human MMP25 (NP_071913.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04205A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MMP25 |
| Target Synonyms | MMP20; MMPL1; MMP-25; MMP20A; MT6MMP; MTMMP6; MT-MMP6; MT6-MMP; MT-MMP 6; MMP25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, K-562 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human MMP25 (NP_071913.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA | Uniprot ID | Q9NPA2 |
Uniprot Id
Q9NPA2
Target Species
Human
Target Name
MMP25
Target Full Name
Matrix metalloproteinase-25
Target Function
May activate progelatinase A.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side. Secreted, extracellular space, extracellular matrix.
Target Protein Families
Peptidase M10A family
Target Tissue Specificity
Expressed predominantly in leukocytes, lung and spleen. Expressed also in colon carcinoma, astrocytoma and glioblastomas.
Target Research Area
Cancer
Target Synonyms
Leukolysin; matrix metallopeptidase 25; matrix metallopeptidase like 1; matrix metalloproteinase 20; Matrix Metalloproteinase 25; Matrix metalloproteinase 25 precursor; Matrix metalloproteinase-25; Membrane type 6 Matrix Metalloproteinase; Membrane type Matrix Metalloproteinase 6 ; Membrane-type matrix metalloproteinase 6; Membrane-type-6 matrix metalloproteinase; MMP 25; MMP-25; MMP20; MMP20A; MMP25; MMP25_HUMAN; MMPL1; MT MMP 6; MT-MMP 6; MT6 MMP; MT6-MMP; MT6MMP; MTMMP6
Target Background
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily, attached to the plasma membrane via a glycosylphosphatidyl inositol anchor. In response to bacterial infection or inflammation, the encoded protein is thought to inactivate alpha-1 proteinase inhibitor, a major tissue protectant against proteolytic enzymes released by activated neutrophils, facilitating the transendothelial migration of neutrophils to inflammatory sites. The encoded protein may also play a role in tumor invasion and metastasis through activation of MMP2. The gene has previously been referred to as MMP20 but has been renamed MMP25.
Notification